4 ms·
New protein therapy shows promise as antidote for carbon monoxide poisoning
- DonHopkins 1y ago>New Protein Therapy Shows Promise as Antidote for Carbon Monoxide Poisoning So Shatner was right all along: not only is Promise Margarine good for lowering your cholesterol level, but it can also treat carbon monoxide poisoning! And it tastes like butter, promise. https://www.youtube.com/watch?v=n3wf717fKFE https://www.youtube.com/watch?v=n3wf717fKFE
- majkinetor 1y agoI don't see a relation of any kind and I hate commercials maybe more than anybody else, but it's always a good time for a funny one with Shatner :)
- DonHopkins 1y agoSheez, I can't believe I have to explain that Shatner shows Promise as antidote for high cholesterol too.
- selimthegrim 1y agoHe just played New Orleans. Somebody should’ve been throwing tubs of Promise margarine at the stage.
- deleted 1y ago[deleted]
- narrator 1y ago[flagged]
- majkinetor 1y agoGod forbid we have alternatives that work in minutes
- lagniappe 1y agoGiven that MB is commonly supported by those with right leaning politics, if the above is true, it won't be reported on for risk of appearing to support the "wrong" party.
- Traubenfuchs 1y ago[flagged]
- jrajav 1y ago"hey, speeding down the highway 35mph over the limit could kill you, especially if you are fat and old. you SHOULD drive under the speed limit, but you don't have to." No, the point is that it could kill other people. Speed all you want when you're on your own private roads. Laws are generally meant to ensure public safety and the ability for us to live and cooperate together with mutual trust. They usually do end up restricting your personal freedoms to that end. Deal with it.
- deleted 1y ago[deleted]
- tekno45 1y ago[flagged]
- jayd16 1y agoIt's been around for a century but it's a political conspiracy to keep it unknown??
- darth_avocado 1y ago
- bananapub 1y agonot very on topic, but for those who missed one of the more surreal reddit threads in history: - [MA] Post-it notes left in apartment [0] - and the update from OP a while later [1] [0]: https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_postit_notes_left_in_apartment/ https://www.reddit.com/r/legaladvice/comments/34l7vo/ma_post... [1]: https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_the_weirdestcreepiest_unexplained_thing/d0wu4ne/?context=3 https://www.reddit.com/r/AskReddit/comments/49zfvb/what_is_t...
- gus_massa 1y agoIt looks like he found a note in his room and see some strange thing in the window, and someone somehow says it's CO but it may be that the OP has unrelated hallucinations. Is this a symptom of CO poisoning? I think you only get sleepy, faint and die.
- maxbond 1y agoChronic exposure can lead to memory loss, yes. You're describing the symptoms of acute exposure.
- hinkley 1y agoCO exposure is accumulative. If you’re around an intense source of it you’re toast. But with a small point source or decent ventilation it kills you slower. And your body produces new blood cells every day, so minor sources like wood smoke or burning a candle don’t dose you enough to be a problem, unless perhaps your day job is as an athlete.
- hinkley 1y agoAlso looks like the half-life of CO in the blood is around five hours.
- phatskat 1y agoReading in a bit more, the second post links to a comment thread where further down they talk about post-it notes. The original thread about the post its had some updates along the lines of: someone in comments suggested OP get a CO detector. OP says “ya know, I have one. Maybe I should take it out of the box and plug it in.” Later OP said their detector rated the CO at 100ppm! They went to the hospital lol. Last update I saw was four months after - OP was guessing their recovery would go on for another year, and there was likely some permanent damage but overall they felt confident at getting back to 80%, maybe even 99%.
- dtgriscom 1y agoHow is this administered? Seems like a crucial detail to omit.
- DonHopkins 1y agoYou can spread it on bread, melt it over pancakes, rub it all over corn on the cob, put it in baked potatoes, etc, promise!
- elric 1y ago> This has the potential to become a rapid, intravenous antidote for carbon monoxide So intravenously, presumably.
- searine 1y agoThis research was funded by multiple NIH grants, a Department of Defense grant, and the Martin Family Foundation.
- jfarlow 1y agoHere's the full sequence of the protein, found in the supplement [1] KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH It is a protein encoding the PxRcoM-1 heme binding domain with C94S mutation and a C-terminal 6xHis tag (RcoM-HBD-C94S) [1] https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementary-materials https://www.pnas.org/doi/10.1073/pnas.2501389122#supplementa...
- sunrunner 1y agoThis looks like an puzzle input to a day from Advent of Code.
- meisel 1y agoThanks for that sequence, I can really picture it now
- dekhn 1y agoYou can search for it here: https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAETEQHKLEQENPGIVWLDQHGRVTAENDVALQILGPAGEQSLGVAQDSLEGIDVVQLHPEKSRDKLRFLLQSKDVGGSPVKSPPPVAMMINIPDRILMIKVSSMIAAGGASGTSMIFYDVTDLTTEPSGLPAGGSAPSHHHHHH https://alphafold.ebi.ac.uk/search/sequence/KSSEPASVSAAERRAE... and in principle get the AlphaFold predicted structure (I couldn't find an experimentally determined one). However, like nearly all EBI resources, the web server timed out before I could get a link to the prediction.
- immibis 1y agoIsn't it strange to see protein codes spreading the same way magnet links or AACS encryption keys might.
- winocm 1y agoIf you want to download SARS-CoV-2, here you go: https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2 https://www.ncbi.nlm.nih.gov/nuccore/NC_045512.2
- deleted 1y ago[deleted]
- kazinator 1y agoThe existing methylene blue substance is also effective in cases of CO poisoning. 1933 paper: https://journals.physiology.org/doi/abs/10.1152/ajplegacy.1933.104.1.139 https://journals.physiology.org/doi/abs/10.1152/ajplegacy.19... "Methylene Blue as an Antidote to CO Poisoning", Matilda Moldenhauer Brooks
- skadamou 1y agoThis paper is interesting but I want to point out there is a difference between a research paper showing that something is hypothetically feasible and something that is actually useful clinically. Clinically, methylene blue is used to treat a different condition, methemeglobinemia and is not used to treat carbon monoxide poisoning which relies on hyperbaric oxygen therapy.
- kazinator 1y agoThe researcher used non-human animals; it worked on them. The hypothetical part was only that it might also work on humans. In any case, it seems the result was good enough as a clinical trial from the point of view of veterinary medicine, in regard to those specific types of animals.
- amy_petrik 1y agoWe really shouldn't be taking chemicals used on animals for veteran purposes and use them on humans too. For example, ivermectin. It's a drug meant for horses similar to another horse tranquilizer, ketamine. Can you imagine a human taking ivermectin or ketamine?!? I remember during COVID people were shooting up horse medicine and it was just really bad and upsetting, like these people were crazy. I wish Kamala had won and would have banned this horse medicines like ivermectin. And now this whole methylene blue thing, RFK takes methylene blue. I mean, guys, this isn't even a horse veteran medicine, it's basically ink used to stain cells. I'm sorry, but everything that has an ink or pigmented color it, there is no way on earth it has a medicinal purpose. I mean. It's ink, nothing more.
- hinkley 1y ago> Infused in the bloodstream, scavenger hemoproteins like RcoM-HBD-CCC rapidly bind to carbon monoxide molecules, reducing the time it takes to clear half of the carbon monoxide in the blood to less than a minute, compared to more than hour with pure oxygen therapy and five hours without any treatment.
- deleted 1y ago[deleted]
- lawlessone 1y agoI can see a market in selling this to urban cyclists.. I've seen people doing that get quite a bit of exhaust fumes to the face.
- hinkley 1y agoBreath control is an underrated skill.
- heyoleftycunts 1y ago[flagged]
- sandworm101 1y agoCO poisioning is one of those strange cases treatable using scuba diving. Recompression therapy, which can be theoretically aped under water, can be like magic. In some cases the patient just wakes up like nothing is wrong. No drugs. No invasive treatment. Get deep enough and hemoglobin isnt totally necessary for getting O2 where it needs to be. https://www.ncbi.nlm.nih.gov/books/NBK470531/ https://www.ncbi.nlm.nih.gov/books/NBK470531/
- pfdietz 1y agoThis looks like a therapy you can only get once in your life, after which it has acted like a vaccine and your immune system would react to it.
- isk517 1y agoIf getting carbon monoxide poisoning once isn't enough to make you invest in a few detectors then I don't know what will
- deleted 1y ago[deleted]
- dekhn 1y agoTypically, protein therapeutics are "humanized" before being pushed through the drug approval process. Part of that is ensuring that the therapeutic isn't extremely likely to trigger an immune response. It's a nontrivial problem.
- pfdietz 1y agoThose are usually antibodies, aren't they? This isn't an antibody. https://en.wikipedia.org/wiki/Humanized_antibody https://en.wikipedia.org/wiki/Humanized_antibody
- PaulHoule 1y agoI guess CO kills you because it sticks to a protein (Hemoglobin), this is a protein that it binds even tighter to. What I find hilarious though is that my RSS reader loves to show me articles about ways of turning the harmful gas CO2 into the useful gas CO, back when I was a kid it was the other way around!