4 ms·

It's relatively simple actually. It just what's called a "codon map" to map "codons" (3 letter sequences) to amino acids (the building blocks of proteins), just

It's relatively simple actually. It just what's called a "codon map" to map "codons" (3 letter sequences) to amino acids (the building blocks of proteins), just as ribosomes do in cells. Here's a codon map for example: http://patentimages.storage.googleapis.com/WO2000052183A1/imgf000059_0001.png http://patentimages.storage.googleapis.com/WO2000052183A1/im...

wuschel 13y ago
I agree: A bit more background information would be good. But I confess I am interested. I fooled around a bit with a nucleotide sequence of Homo sapiens mRNA for prepro cortistatin like peptide, complete cds.|len=368, as taken from http://www.genomatix.de/online_help/help/sequence_formats.html http://www.genomatix.de/online_help/help/sequence_formats.ht... ACAAGATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCC CCTGGAGGGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGC CTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGG AAGCTCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCCGCGCGCCGGGACAGAATGCC CTGCAGGAACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAG TTTAATTACAGACCTGAA After some (random) clicking on some nucleotide spots this sequence got me this, assuming that the "standard" genetic code handles homo sapiens mRNA: ID VIRT5672 Unreviewed; 66 AA. AC VIRT5672; DE Translation of nucleotide sequence generated on ExPASy DE on 20-Nov-2013 by 87.150.48.254. CC -!- This virtual protein sequence will automatically be deleted CC from the server after a few days. DR SWISS-2DPAGE; VIRT5672; VIRTUAL. SQ SEQUENCE 66 AA; 6E48167C288239C3 CRC64. GARHWPGRST QTTKRGKSGG CFSLFLPLPA YARCLGRWGH PPGAGQRWPW PRRAAAAGGR GTMASC // Sequence in FASTA format >VIRT5672 GARHWPGRSTQTTKRGKSGGCFSLFLPLPAYARCLGRWGHPPGAGQRWPWPRRAAAAGGR GTMASC What (concrete) applications does it have except being a theoretical transcoder?
- sp332 13y ago
  Does IUPAC use 'T' to stand for uracil in RNA? I always used 'U'.
merry-year 13y ago
Hmmm, are you saying that you can predict the exact protein that, say a human cell, will produce for every DNA sequence. I had the impression that the whole mRNA + ribosomes process is extremely complex and poorly understood.
- shiven 13y ago
  You are thinking of splicing. http://en.wikipedia.org/wiki/RNA_splicing http://en.wikipedia.org/wiki/RNA_splicing And, you are right. DNA => mRNA ≠ Protein, in a direct manner because of it.

wuschel 13y ago

I agree: A bit more background information would be good. But I confess I am interested. I fooled around a bit with a nucleotide sequence of Homo sapiens mRNA for prepro cortistatin like peptide, complete cds.|len=368, as taken from http://www.genomatix.de/online_help/help/sequence_formats.html http://www.genomatix.de/online_help/help/sequence_formats.ht... ACAAGATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCC CCTGGAGGGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGC CTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGG AAGCTCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCCGCGCGCCGGGACAGAATGCC CTGCAGGAACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAG TTTAATTACAGACCTGAA After some (random) clicking on some nucleotide spots this sequence got me this, assuming that the "standard" genetic code handles homo sapiens mRNA: ID VIRT5672 Unreviewed; 66 AA. AC VIRT5672; DE Translation of nucleotide sequence generated on ExPASy DE on 20-Nov-2013 by 87.150.48.254. CC -!- This virtual protein sequence will automatically be deleted CC from the server after a few days. DR SWISS-2DPAGE; VIRT5672; VIRTUAL. SQ SEQUENCE 66 AA; 6E48167C288239C3 CRC64. GARHWPGRST QTTKRGKSGG CFSLFLPLPA YARCLGRWGH PPGAGQRWPW PRRAAAAGGR GTMASC // Sequence in FASTA format >VIRT5672 GARHWPGRSTQTTKRGKSGGCFSLFLPLPAYARCLGRWGHPPGAGQRWPWPRRAAAAGGR GTMASC What (concrete) applications does it have except being a theoretical transcoder?

sp332 13y ago
Does IUPAC use 'T' to stand for uracil in RNA? I always used 'U'.

merry-year 13y ago

Hmmm, are you saying that you can predict the exact protein that, say a human cell, will produce for every DNA sequence. I had the impression that the whole mRNA + ribosomes process is extremely complex and poorly understood.

shiven 13y ago
You are thinking of splicing. http://en.wikipedia.org/wiki/RNA_splicing http://en.wikipedia.org/wiki/RNA_splicing And, you are right. DNA => mRNA ≠ Protein, in a direct manner because of it.