4 ms·

Translate a nucleotide (DNA/RNA) sequence to a protein sequence

15 points by e0m 13y ago

kens 13y ago
Why is this here? Holley, Khorana, and Nirenberg got the Nobel Prize for figuring out the genetic code in 1968 so this isn't a new result. And I don't see anything technically interesting about the implementation of this web page. (Not trying to be snarky, just puzzled.) If this page gave the 3-D structure of the protein, that would be cool. Edit: if you don't understand the genetic code and DNA, you really should learn a bit about it since it will help you understand a whole lot of tech things. See http://en.wikipedia.org/wiki/Genetic_code http://en.wikipedia.org/wiki/Genetic_code
shaohua 13y ago
WHy is this here?
nzukoski 13y ago
If someone knows how this works, I'd love an explanation of it.
- davecap1 13y ago
  It's relatively simple actually. It just what's called a "codon map" to map "codons" (3 letter sequences) to amino acids (the building blocks of proteins), just as ribosomes do in cells. Here's a codon map for example: http://patentimages.storage.googleapis.com/WO2000052183A1/imgf000059_0001.png http://patentimages.storage.googleapis.com/WO2000052183A1/im...
  - wuschel 13y ago
    I agree: A bit more background information would be good. But I confess I am interested. I fooled around a bit with a nucleotide sequence of Homo sapiens mRNA for prepro cortistatin like peptide, complete cds.|len=368, as taken from http://www.genomatix.de/online_help/help/sequence_formats.html http://www.genomatix.de/online_help/help/sequence_formats.ht... ACAAGATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCC CCTGGAGGGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGC CTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGG AAGCTCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCCGCGCGCCGGGACAGAATGCC CTGCAGGAACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAG TTTAATTACAGACCTGAA After some (random) clicking on some nucleotide spots this sequence got me this, assuming that the "standard" genetic code handles homo sapiens mRNA: ID VIRT5672 Unreviewed; 66 AA. AC VIRT5672; DE Translation of nucleotide sequence generated on ExPASy DE on 20-Nov-2013 by 87.150.48.254. CC -!- This virtual protein sequence will automatically be deleted CC from the server after a few days. DR SWISS-2DPAGE; VIRT5672; VIRTUAL. SQ SEQUENCE 66 AA; 6E48167C288239C3 CRC64. GARHWPGRST QTTKRGKSGG CFSLFLPLPA YARCLGRWGH PPGAGQRWPW PRRAAAAGGR GTMASC // Sequence in FASTA format >VIRT5672 GARHWPGRSTQTTKRGKSGGCFSLFLPLPAYARCLGRWGHPPGAGQRWPWPRRAAAAGGR GTMASC What (concrete) applications does it have except being a theoretical transcoder?
    - sp332 13y ago
      Does IUPAC use 'T' to stand for uracil in RNA? I always used 'U'.
  - merry-year 13y ago
    Hmmm, are you saying that you can predict the exact protein that, say a human cell, will produce for every DNA sequence. I had the impression that the whole mRNA + ribosomes process is extremely complex and poorly understood.
    - shiven 13y ago
      You are thinking of splicing. http://en.wikipedia.org/wiki/RNA_splicing http://en.wikipedia.org/wiki/RNA_splicing And, you are right. DNA => mRNA ≠ Protein, in a direct manner because of it.
fogonthedowns 13y ago
These have existed for 13 years on the web or as long as I can remember. This is not very interesting.
e0m 13y ago
The title of the post is supposed to be: CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC It got changed. http://www.wolframalpha.com/input/?i=CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC http://www.wolframalpha.com/input/?i=CGCATTCCGTTTCGCGAAGATAG...
e0m 13y ago
It spells out RIP FRED SANGER
e0m 13y ago
I re-posted this at https://news.ycombinator.com/item?id=6769875 https://news.ycombinator.com/item?id=6769875 CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC It links directly to the Wolfram Alpha sequence, which more quickly illustrates what's hidden in this sequence.

15 points by e0m 13y ago

kens 13y ago

Why is this here? Holley, Khorana, and Nirenberg got the Nobel Prize for figuring out the genetic code in 1968 so this isn't a new result. And I don't see anything technically interesting about the implementation of this web page. (Not trying to be snarky, just puzzled.) If this page gave the 3-D structure of the protein, that would be cool. Edit: if you don't understand the genetic code and DNA, you really should learn a bit about it since it will help you understand a whole lot of tech things. See http://en.wikipedia.org/wiki/Genetic_code http://en.wikipedia.org/wiki/Genetic_code

shaohua 13y ago

WHy is this here?

nzukoski 13y ago

If someone knows how this works, I'd love an explanation of it.

davecap1 13y ago
It's relatively simple actually. It just what's called a "codon map" to map "codons" (3 letter sequences) to amino acids (the building blocks of proteins), just as ribosomes do in cells. Here's a codon map for example: http://patentimages.storage.googleapis.com/WO2000052183A1/imgf000059_0001.png http://patentimages.storage.googleapis.com/WO2000052183A1/im...
- wuschel 13y ago
  I agree: A bit more background information would be good. But I confess I am interested. I fooled around a bit with a nucleotide sequence of Homo sapiens mRNA for prepro cortistatin like peptide, complete cds.|len=368, as taken from http://www.genomatix.de/online_help/help/sequence_formats.html http://www.genomatix.de/online_help/help/sequence_formats.ht... ACAAGATGCCATTGTCCCCCGGCCTCCTGCTGCTGCTGCTCTCCGGGGCCACGGCCACCGCTGCCCTGCC CCTGGAGGGTGGCCCCACCGGCCGAGACAGCGAGCATATGCAGGAAGCGGCAGGAATAAGGAAAAGCAGC CTCCTGACTTTCCTCGCTTGGTGGTTTGAGTGGACCTCCCAGGCCAGTGCCGGGCCCCTCATAGGAGAGG AAGCTCGGGAGGTGGCCAGGCGGCAGGAAGGCGCACCCCCCCAGCAATCCGCGCGCCGGGACAGAATGCC CTGCAGGAACTTCTTCTGGAAGACCTTCTCCTCCTGCAAATAAAACCTCACCCATGAATGCTCACGCAAG TTTAATTACAGACCTGAA After some (random) clicking on some nucleotide spots this sequence got me this, assuming that the "standard" genetic code handles homo sapiens mRNA: ID VIRT5672 Unreviewed; 66 AA. AC VIRT5672; DE Translation of nucleotide sequence generated on ExPASy DE on 20-Nov-2013 by 87.150.48.254. CC -!- This virtual protein sequence will automatically be deleted CC from the server after a few days. DR SWISS-2DPAGE; VIRT5672; VIRTUAL. SQ SEQUENCE 66 AA; 6E48167C288239C3 CRC64. GARHWPGRST QTTKRGKSGG CFSLFLPLPA YARCLGRWGH PPGAGQRWPW PRRAAAAGGR GTMASC // Sequence in FASTA format >VIRT5672 GARHWPGRSTQTTKRGKSGGCFSLFLPLPAYARCLGRWGHPPGAGQRWPWPRRAAAAGGR GTMASC What (concrete) applications does it have except being a theoretical transcoder?
  - sp332 13y ago
    Does IUPAC use 'T' to stand for uracil in RNA? I always used 'U'.
- merry-year 13y ago
  Hmmm, are you saying that you can predict the exact protein that, say a human cell, will produce for every DNA sequence. I had the impression that the whole mRNA + ribosomes process is extremely complex and poorly understood.
  - shiven 13y ago
    You are thinking of splicing. http://en.wikipedia.org/wiki/RNA_splicing http://en.wikipedia.org/wiki/RNA_splicing And, you are right. DNA => mRNA ≠ Protein, in a direct manner because of it.

fogonthedowns 13y ago

These have existed for 13 years on the web or as long as I can remember. This is not very interesting.

e0m 13y ago

The title of the post is supposed to be: CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC It got changed. http://www.wolframalpha.com/input/?i=CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC http://www.wolframalpha.com/input/?i=CGCATTCCGTTTCGCGAAGATAG...

e0m 13y ago

It spells out RIP FRED SANGER

e0m 13y ago

I re-posted this at https://news.ycombinator.com/item?id=6769875 https://news.ycombinator.com/item?id=6769875 CGCATTCCGTTTCGCGAAGATAGCGCGAACGGCGAACGC It links directly to the Wolfram Alpha sequence, which more quickly illustrates what's hidden in this sequence.