4 ms·
Reminds me of this guy I met at a CTF. He decided that punctuation generally is unnecessary. What's the use of having so many different symbols if the only thin
by gnull 4y ago
Reminds me of this guy I met at a CTF. He decided that punctuation generally is unnecessary. What's the use of having so many different symbols if the only thing they denote is pauses between words.
so when he wrote something . he used only periods to denote pauses . no other punctuation symbols . no capital letters . some people were thinking that his periods stand for perl concatenation operators . i dont know if he is still doing this . i hope he stopped
- 6th 4y agoProbably scored a. sweet gig. writing lines. for. Captain. Kirk.
- dredmorbius 4y agoWriting is a recorded symbolic convention for the benefit of the sufficiently educated reader. Eschewingallpunctuationforscriptocontinuaisofcourseppossiblethoughitishelltoread.Itisevendifficulttotypewithoutaddingthespacesreflexivelyifindasipostthis. <https://en.wikipedia.org/wiki/Scriptio_continua https://en.wikipedia.org/wiki/Scriptio_continua> There's a reason monks of old read aloud. It was about the only way to confirm the actual meaning of a text.
- c22 4y agoUcnevndrpsmevwlsandstllmkesmthgrdblbutbrly.
- dredmorbius 4y agobrylrnr'ydnsdrwkcbttrwdnslwvhtprD (Bass-ackwards hint: "Arabic" expresses poorly when vowels are excluded.)
- sundarurfriend 4y agoactually i kinda love that . punctuation is semi arbitrary anyway . and this is actually much easier to read than the usual literary english full of semicolons and dashes . mimics speech much better too .
- jameshart 4y agoI think it mimics a certain kind of speech. Some people do talk like that . All complete thoughts . Sequential. Other people—and I very much count myself among them—have a less linear, more tree-like mode of expression; where the ideas, instead of building on what came before, are being laid out out of order – the ideas aren’t completed – and more complex punctuation is needed to establish the relationships between those thoughts. It sounds like I’m saying the former is less sophisticated than the latter. I don’t think that’s true. I think we should probably try to express our ideas in a way that doesn’t require out-of-sequence reasoning. Short, simple sentences. With clear meanings. Building on one another. Much easier to follow. The tree-like mode of endless nested parentheticals and asides is just a rendering of an incomplete thought process. Not better or more sophisticated. Just still in progress.