Please read carefully my previous post. Protein sequence != RNA sequence. I already stated that both coding RNA sequences are different. It is their product, t

Please read carefully my previous post. Protein sequence != RNA sequence. I already stated that both coding RNA sequences are different. It is their product, the protein sequence, that is 100% identical in both sequence and structure. The protein that, as you mentioned, is presented as an antigen to the immune system. If you don’t believe me, and since you already found the FASTA mRNA sequence (or, more specifically, its cDNA equivalent) for both vaccines, you can translate[1] each spike protein RNA section and then align[2] both translated protein sequences. This is what you get: #======================================= # # Aligned_sequences: 2 # 1: Pfizer # 2: Moderna # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 1273 # Identity: 1273/1273 (100.0%) # Similarity: 1273/1273 (100.0%) # Gaps: 0/1273 ( 0.0%) # Score: 6727.0 # # #======================================= Pfizer 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 Pfizer 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 ... Pfizer 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 Pfizer 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 ||||||||||||||||||||||| Moderna 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 [1]: https://web.expasy.org/translate/ https://web.expasy.org/translate/ [2]: https://www.ebi.ac.uk/Tools/psa/emboss_needle/ https://www.ebi.ac.uk/Tools/psa/emboss_needle/