3 ms·

here. do the diff yourself: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/bl

here. do the diff yourself: https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV2-spike-encoding-mRNA-sequences-for-vaccines-BNT-162b2-and-mRNA-1273/blob/main/Figure1Figure2_032321.fasta https://github.com/NAalytics/Assemblies-of-putative-SARS-CoV... I’m not gonna go into how the virus was sequenced or what the process to generate the vaccine was, but in this case, I believe your claim of being 100% identical is wrong.

flobosg 5y ago
Please read carefully my previous post. Protein sequence != RNA sequence. I already stated that both coding RNA sequences are different. It is their product, the protein sequence, that is 100% identical in both sequence and structure. The protein that, as you mentioned, is presented as an antigen to the immune system. If you don’t believe me, and since you already found the FASTA mRNA sequence (or, more specifically, its cDNA equivalent) for both vaccines, you can translate[1] each spike protein RNA section and then align[2] both translated protein sequences. This is what you get: #======================================= # # Aligned_sequences: 2 # 1: Pfizer # 2: Moderna # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 1273 # Identity: 1273/1273 (100.0%) # Similarity: 1273/1273 (100.0%) # Gaps: 0/1273 ( 0.0%) # Score: 6727.0 # # #======================================= Pfizer 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 Pfizer 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 ... Pfizer 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 Pfizer 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 ||||||||||||||||||||||| Moderna 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 [1]: https://web.expasy.org/translate/ https://web.expasy.org/translate/ [2]: https://www.ebi.ac.uk/Tools/psa/emboss_needle/ https://www.ebi.ac.uk/Tools/psa/emboss_needle/
- rantwasp 5y ago
  okay. so the vaccine itself is different, but the end result spike protein is the same. I assumed that the spike proteins would look similar (99.5%+) and was actually expecting differences in the “area that holds the protein together at the base where it would normally bind to the useful virus payload”. i guess i was wrong

flobosg 5y ago

Please read carefully my previous post. Protein sequence != RNA sequence. I already stated that both coding RNA sequences are different. It is their product, the protein sequence, that is 100% identical in both sequence and structure. The protein that, as you mentioned, is presented as an antigen to the immune system. If you don’t believe me, and since you already found the FASTA mRNA sequence (or, more specifically, its cDNA equivalent) for both vaccines, you can translate[1] each spike protein RNA section and then align[2] both translated protein sequences. This is what you get: #======================================= # # Aligned_sequences: 2 # 1: Pfizer # 2: Moderna # Matrix: EBLOSUM62 # Gap_penalty: 10.0 # Extend_penalty: 0.5 # # Length: 1273 # Identity: 1273/1273 (100.0%) # Similarity: 1273/1273 (100.0%) # Gaps: 0/1273 ( 0.0%) # Score: 6727.0 # # #======================================= Pfizer 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1 MFVFLVLLPLVSSQCVNLTTRTQLPPAYTNSFTRGVYYPDKVFRSSVLHS 50 Pfizer 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 51 TQDLFLPFFSNVTWFHAIHVSGTNGTKRFDNPVLPFNDGVYFASTEKSNI 100 ... Pfizer 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 |||||||||||||||||||||||||||||||||||||||||||||||||| Moderna 1201 QELGKYEQYIKWPWYIWLGFIAGLIAIVMVTIMLCCMTSCCSCLKGCCSC 1250 Pfizer 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 ||||||||||||||||||||||| Moderna 1251 GSCCKFDEDDSEPVLKGVKLHYT 1273 [1]: https://web.expasy.org/translate/ https://web.expasy.org/translate/ [2]: https://www.ebi.ac.uk/Tools/psa/emboss_needle/ https://www.ebi.ac.uk/Tools/psa/emboss_needle/

rantwasp 5y ago
okay. so the vaccine itself is different, but the end result spike protein is the same. I assumed that the spike proteins would look similar (99.5%+) and was actually expecting differences in the “area that holds the protein together at the base where it would normally bind to the useful virus payload”. i guess i was wrong